Germany
Japan
United Kingdom
China
Goat Anti-CLIC1 / NCC27 (aa45-57) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TVDTKRRTETVQK, from the internal region of the protein sequence according to NP_001279.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CLIC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF |
Goat Anti-CLIC1 / NCC27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TEVHTDTNKIEE, from the internal region of the protein sequence according to NP_001279.2. |
Rabbit polyclonal anti-CLIC1 antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CLIC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 136-166 amino acids from the Central region of human CLIC1. |
Rabbit Polyclonal Anti-CLIC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST |
Rabbit Polyclonal Anti-CLIC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST |
CLIC1 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CLIC1 |
CLIC1 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLIC1