Antibodies

View as table Download

Goat Anti-CLIC1 / NCC27 (aa45-57) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TVDTKRRTETVQK, from the internal region of the protein sequence according to NP_001279.2.

CLIC1 mouse monoclonal antibody, clone 3F9

Applications ELISA, IHC, WB
Reactivities Human

CLIC1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a recombinant human CLIC1 protein.

Rabbit Polyclonal Anti-CLIC1

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RGFTIPEAFRGVHR, corresponding to amino acid residues 195-208 of human CLIC1. Intracellular, C-terminus.

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF

Goat Anti-CLIC1 / NCC27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TEVHTDTNKIEE, from the internal region of the protein sequence according to NP_001279.2.

Rabbit polyclonal anti-CLIC1 antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CLIC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 136-166 amino acids from the Central region of human CLIC1.

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CLIC1

CLIC1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse CLIC1

CLIC1 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified

CLIC1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified