Antibodies

View as table Download

CLK2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLK2

Rabbit polyclonal anti-CLK2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CLK2.

CLK2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 290-319 amino acids from the Central region of human CLK2

Rabbit Polyclonal Anti-CLK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLK2 antibody is: synthetic peptide directed towards the N-terminal region of Human CLK2. Synthetic peptide located within the following region: KFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDF

CLK2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLK2

CLK2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLK2

CLK2 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified