Antibodies

View as table Download

CLPTM1L (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected between amino acids 508-538 of human CLPTM1L

CLPTM1L (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 369-399 amino acids from the C-terminal region of human CLPTM1L

Rabbit Polyclonal Anti-CLPTM1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLPTM1L antibody: synthetic peptide directed towards the middle region of human CLPTM1L. Synthetic peptide located within the following region: KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD

Rabbit Polyclonal Anti-CLPTM1L Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLPTM1L

CLPTM1L rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLPTM1L