CLPTM1L (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected between amino acids 508-538 of human CLPTM1L |
CLPTM1L (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected between amino acids 508-538 of human CLPTM1L |
CLPTM1L (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 369-399 amino acids from the C-terminal region of human CLPTM1L |
Rabbit Polyclonal Anti-CLPTM1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLPTM1L antibody: synthetic peptide directed towards the middle region of human CLPTM1L. Synthetic peptide located within the following region: KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD |
Rabbit Polyclonal Anti-CLPTM1L Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLPTM1L |
CLPTM1L rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLPTM1L |