Antibodies

View as table Download

CLU rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLU

Rabbit anti-CLU Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLU

Clusterin (CLU) (488-501) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic peptide from the C-terminus of human CLU/Clusterin (NP_001822.2; NP_976084.1).

Clusterin (CLU) (Alpha) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Polyclonal Antibody against CLU

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKALQEYRKKHREE, from the C Terminus of the protein sequence according to NP_001822.2; NP_976084.1.

Clusterin (CLU) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 71-99 amino acids from the N-terminal region of human CLU

Goat Anti-Clusterin / ApoJ (mouse) Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKALQEYRRKSRAE, from the C Terminus of the protein sequence according to NP_038520.1.

Rabbit Polyclonal Clusterin Antibody

Applications IHC, WB
Reactivities Human
Immunogen Clusterin antibody was raised recombinant human Clusterin isoform 1.

Anti-CLU Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 230 amino acids of human clusterin

Rabbit Polyclonal Anti-CLU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN

Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CLU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLU

Clusterin alpha chain Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human Clusterin alpha chain (NP_001822.3).
Modifications Unmodified

Clusterin alpha chain Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human Clusterin alpha chain (NP_976084.1).
Modifications Unmodified

CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated