Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CMTM2 (CKLF2) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CKLF2. |
Rabbit Polyclonal anti-CMTM2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CMTM2 antibody: synthetic peptide directed towards the N terminal of human CMTM2. Synthetic peptide located within the following region: DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL |
CMTM2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CMTM2 |
CMTM2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CMTM2 |
Active filters
Target Symbol
- CMTM2