Antibodies

Jump to Filters
View as table Download
Cklfsf8 (CMTM8) Rabbit Polyclonal Antibody
TA337583

USD 375.00

5 Days

Rabbit Polyclonal Anti-CMTM8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMTM8 antibody: synthetic peptide directed towards the middle region of human CMTM8. Synthetic peptide located within the following region: CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN
Cklfsf8 (CMTM8) Rabbit Polyclonal Antibody
TA350680

USD 345.00

In Stock

Rabbit Polyclonal Anti-CMTM8 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CMTM8
CMTM8 Rabbit Polyclonal Antibody
TA366805

USD 380.00

4 Weeks

CMTM8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CMTM8
CMTM8 Rabbit Polyclonal Antibody
TA384018

USD 380.00

4 Weeks

CMTM8 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human CMTM8. AA range:101-150