Antibodies

View as table Download

Rabbit polyclonal CNIH2 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CNIH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 31-59 amino acids from the N-terminal region of human CNIH2.

Rabbit Polyclonal Anti-CNIH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNIH2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNIH2. Synthetic peptide located within the following region: AFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKN

Rabbit Polyclonal Anti-CNIH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNIH2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNIH2. Synthetic peptide located within the following region: LWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLY