Rabbit polyclonal anti-CNN2 antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CNN2. |
Rabbit polyclonal anti-CNN2 antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CNN2. |
CNN2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 8-36 amino acids from the N-terminal region of human CNN2 |
Rabbit Polyclonal Anti-CNN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF |
Goat Anti-Calponin 2 / CNN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DPGEVPEYPPYYQEE, from the internal region (near C Terminus) of the protein sequence according to NP_004359.1; NP_958434.1. |
Rabbit Polyclonal Anti-CNN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC |
Carrier-free (BSA/glycerol-free) CNN2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
CNN2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNN2 |
CNN2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
CNN2 mouse monoclonal antibody,clone 2B5, Biotinylated
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Biotin |
CNN2 mouse monoclonal antibody,clone 2B5, HRP conjugated
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | HRP |
CNN2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |