Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-CNP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CNP |
Rabbit Polyclonal Anti-CNPase Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNPase Antibody: Peptide sequence around aa.80~84 (M-V-S-A-D |
CNPase (CNP) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH conjugated corresponded to a region of the CNPase gene product shared between the Human (NP_149124) and Mouse (P16330) sequences. After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. |
rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase |
Rabbit Polyclonal Anti-CNP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the middle region of human CNP. Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII |
Rabbit Polyclonal Anti-CNP Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF |
Rabbit Polyclonal CNPase Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Reacts with residues 68-84 of the 46-48 (doublet) kDa human, CNPase protein (74% sequence identity and 94% sequence similarity to mouse and rat). |
CNP mouse monoclonal antibody,clone OTI3C3
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- CNP