Antibodies

Jump to Filters
View as table Download
CNTD2 Rabbit Polyclonal Antibody
TA315816

USD 345.00

In Stock

Rabbit polyclonal anti-CNTD2 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CNTD2.
CNTD2 Rabbit Polyclonal Antibody
TA335458

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNTD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNTD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNTD2. Synthetic peptide located within the following region: PDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMEYLGL