Mouse monoclonal CASPR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse monoclonal CASPR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CNTNAP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNTNAP1 antibody: synthetic peptide directed towards the N terminal of human CNTNAP1. Synthetic peptide located within the following region: LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS |
CNTNAP1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNTNAP1 |
Caspr1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human Caspr1 (NP_003623.1). |
Modifications | Unmodified |