Germany
Japan
United Kingdom
China
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat |
| Immunogen | Purified collagen type VI from human placenta. |
Antibodies
View as table Download
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Biotin |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) goat polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Human type VI collagen. Antiserum to human type VI collagen was raised by repeated immunisation of goats with highly purified antigen. |
Collagen VI (COL6A1) goat polyclonal antibody, Azide Free
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Immunogen | Collagen VI antibody was raised against Human type VI Collagen. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat |
| Immunogen | Purified collagen type VI from human placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated |
Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human COL6A1 |
Collagen VI (COL6A1) alpha 1 chain rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human COL6A1 |
Rabbit Polyclonal Anti-COL6A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ |
Collagen VI/COL6A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-250 of human Collagen VI/Collagen VI/COL6A1 (NP_001839.2). |
| Modifications | Unmodified |
COL6A1 mouse monoclonal antibody,clone OTI1G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Active filters
Target Symbol
- COL6A1