Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-COLEC12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COLEC12 antibody: synthetic peptide directed towards the middle region of human COLEC12. Synthetic peptide located within the following region: GLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDC |
Rabbit Polyclonal Anti-COLEC12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COLEC12 antibody: synthetic peptide directed towards the N terminal of human COLEC12. Synthetic peptide located within the following region: AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQ |
Rabbit Polyclonal Anti-COLEC12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COLEC12 antibody: synthetic peptide directed towards the middle region of human COLEC12. Synthetic peptide located within the following region: AGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGPSGDPGPPG |
Rabbit Polyclonal Anti-COLEC12 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human COLEC12 |
COLEC12 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human COLEC12 (NP_569057.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- COLEC12