Antibodies

View as table Download

Anti-COMT Goat Polyclonal Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%).

Rabbit polyclonal COMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COMT.

Goat Polyclonal Antibody against COMT (Internal Region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QDIIPQLKKKYDVD, from the internal region of the protein sequence according to NP_000745.1; NP_009294.1.

Rabbit Polyclonal Anti-COMT Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Rabbit (93%); Horse (87%); Mouse, Rat, Hamster, Bat, Pig (80%).

Rabbit Polyclonal Anti-COMT Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from N-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (95%); Marmoset (89%); Hamster (84%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Pig (100%); Hamster, Elephant, Panda, Rabbit, Horse (93%); Dog, Turkey, Chicken, Xenopus (87%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan, Gibbon, Rabbit (95%); Monkey, Marmoset, Horse (89%); Mouse, Rat, Hamster (84%).

Rabbit Polyclonal Anti-COMT Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from C-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%).

COMT rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human COMT

COMT rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human COMT

COMT rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human COMT

COMT rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human COMT

COMT Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-221 of human COMT (NP_009294.1).
Modifications Unmodified

COMT Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified