Antibodies

Jump to Filters
View as table Download
FAM36A (COX20) Rabbit Polyclonal Antibody
TA337607

USD 375.00

5 Days

Rabbit Polyclonal Anti-COX20 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COX20 antibody: synthetic peptide directed towards the C terminal of human COX20. Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
FAM36A (COX20) Rabbit Polyclonal Antibody
TA361851

USD 360.00

5 Days

COX20 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FAM36A