Rabbit Polyclonal antibody to COX6B1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 23 and 86 of COX6B1 (Uniprot ID#P14854) |
USD 450.00
2 Weeks
Rabbit Polyclonal Anti-COX6B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COX6B1 antibody is: synthetic peptide directed towards the N-terminal region of Human COX6B1. Synthetic peptide located within the following region: TAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQS |
Anti-COX6B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
COX6B1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human COX6B1 |
COX6B1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human COX6B1 (NP_001854.1). |
| Modifications | Unmodified |
COX6B1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human COX6B1 (NP_001854.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
