Antibodies

Jump to Filters
View as table Download
COX7B Rabbit Polyclonal Antibody
TA340027

USD 375.00

5 Days

Rabbit Polyclonal Anti-COX7B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COX7B antibody: synthetic peptide directed towards the N terminal of human COX7B. Synthetic peptide located within the following region: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI
COX7B Rabbit Polyclonal Antibody
TA323104

USD 345.00

4 Weeks

Anti-COX7B Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-79 amino acids of human cytochrome c oxidase subunit VIIb
COX7B Rabbit Polyclonal Antibody
TA323105

USD 345.00

In Stock

Anti-COX7B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-79 amino acids of human cytochrome c oxidase subunit VIIb