Antibodies

Jump to Filters
View as table Download
Cpa3 Rabbit Polyclonal Antibody
TA346305

USD 475.00

5 Days

Rabbit Polyclonal Anti-Cpa3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpa3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ILIHDLQEEIEKQFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMV
CPA3 (Center) Rabbit Polyclonal Antibody
AP51045PU-N

USD 450.00

2 Weeks

CPA3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of Human CPA3.
CPA3 Rabbit Polyclonal Antibody
TA375025

USD 220.00

3 Weeks

CPA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-417 of human CPA3 (NP_001861.2).
Modifications Unmodified