Germany
Japan
United Kingdom
China
Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2 |
Antibodies
View as table Download
Rabbit polyclonal anti-CPB2 antibody
| Applications | WB |
| Reactivities | Human (Identities = 100%, Positives = 100% |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPB2. |
Rabbit Polyclonal Anti-CPB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CPB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CPB2 |
CPB2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 310-410 of human CPB2 (NP_001863.3). |
| Modifications | Unmodified |
CPB2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 115-365 of human CPB2 (NP_001863.2). |
| Modifications | Unmodified |
USD 379.00
In Stock
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | HRP |
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CPB2