Rabbit Polyclonal Anti-CPEB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPEB2 antibody: synthetic peptide directed towards the N terminal of human CPEB2. Synthetic peptide located within the following region: FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG |
Rabbit Polyclonal Anti-CPEB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPEB2 antibody: synthetic peptide directed towards the middle region of human CPEB2. Synthetic peptide located within the following region: SNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMH |
Rabbit Polyclonal Anti-CPEB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPEB2 antibody: synthetic peptide directed towards the middle region of human CPEB2. Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL |
Germany
Japan
United Kingdom
China