Antibodies

Jump to Filters
View as table Download
CPLX2 Rabbit Polyclonal Antibody
TA340129

USD 375.00

5 Days

Rabbit Polyclonal Anti-CPLX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPLX2 antibody: synthetic peptide directed towards the N terminal of human CPLX2. Synthetic peptide located within the following region: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
CPLX2 Rabbit Polyclonal Antibody
TA375035

USD 220.00

3 Weeks

CPLX2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human CPLX2 (NP_006641.1).
Modifications Unmodified