Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CPN1 (carboxypeptidase N, polypeptide 1) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CPN1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CPN1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPN1 antibody: synthetic peptide directed towards the middle region of human CPN1. Synthetic peptide located within the following region: FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT |
CPN1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-CPN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPN1 antibody: synthetic peptide directed towards the middle region of human CPN1. Synthetic peptide located within the following region: EWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGD |
CPN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 209-458 of human CPN1 (NP_001299.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CPN1