Rabbit Polyclonal Anti-CPNE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPNE1 antibody: synthetic peptide directed towards the N terminal of human CPNE1. Synthetic peptide located within the following region: TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG |
Rabbit Polyclonal Anti-CPNE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPNE1 antibody: synthetic peptide directed towards the middle region of human CPNE1. Synthetic peptide located within the following region: VQCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSG |
Goat Anti-CPNE1 / Copine 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-APLKPLPPSAKDPA, from the C Terminus of the protein sequence according to NP_690902.1; NP_003906.2. |
CPNE1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human CPNE1 (NP_003906.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
