Antibodies

Jump to Filters
View as table Download
CRABP2 Rabbit Polyclonal Antibody
TA346306

USD 475.00

5 Days

Rabbit Polyclonal Anti-CRABP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRABP2 antibody: synthetic peptide directed towards the middle region of human CRABP2. Synthetic peptide located within the following region: AAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKS
CRABP2 Mouse Monoclonal Antibody [Clone ID: AT2E11]
AM09062PU-S

USD 230.00

2 Weeks

CRABP2 mouse monoclonal antibody, clone AT2E11, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
CRABP2 Rabbit Polyclonal Antibody
TA324128

USD 345.00

In Stock

Anti-CRABP2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.87~91(K-W-E-S-E) derived from Human CRABP2
CRABP2 Rabbit Polyclonal Antibody
TA346307

USD 475.00

5 Days

Rabbit Polyclonal Anti-CRABP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRABP2 antibody: synthetic peptide directed towards the middle region of human CRABP2. Synthetic peptide located within the following region: FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI
CRABP2 Mouse Monoclonal Antibody [Clone ID: AT2E11]
AM09062PU-N

USD 340.00

2 Weeks

CRABP2 mouse monoclonal antibody, clone AT2E11, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
CRABP2 (C-term) Rabbit Polyclonal Antibody
AP51069PU-N

USD 450.00

2 Weeks

CRABP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 86-116 amino acids from the C-terminal region of Human CRABP2.
CRABP2 Rabbit Polyclonal Antibody
TA313145

USD 345.00

4 Weeks

Rabbit polyclonal anti-CRABP2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CRABP2.
CRABP2 Rabbit Polyclonal Antibody
TA330909

USD 375.00

5 Days

Rabbit Polyclonal Anti-CRABP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRABP2 antibody is: synthetic peptide directed towards the middle region of Human CRABP2. Synthetic peptide located within the following region: PCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVV
CRABP2 Mouse Monoclonal Antibody [Clone ID: OTI3C11]
CF800027

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CRABP2 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
CRABP2 Mouse Monoclonal Antibody [Clone ID: OTI10D6]
CF800069

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CRABP2 mouse monoclonal antibody, clone OTI10D6 (formerly 10D6)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
CRABP2 Rabbit Polyclonal Antibody
TA349827

USD 345.00

In Stock

Rabbit Polyclonal Anti-CRABP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CRABP2
CRABP2 Rabbit Polyclonal Antibody
TA369052

USD 380.00

4 Weeks

CRABP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CRABP2
CRABP2 Rabbit Polyclonal Antibody
TA375064

USD 220.00

3 Weeks

CRABP2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CRABP2 (NP_001869.1).
Modifications Unmodified
CRABP2 Mouse Monoclonal Antibody [Clone ID: OTI3C11]
TA800027

USD 379.00

In Stock

CRABP2 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
CRABP2 Mouse Monoclonal Antibody [Clone ID: OTI3C11]
TA800027S

USD 159.00

2 Days

CRABP2 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
CRABP2 Mouse Monoclonal Antibody [Clone ID: OTI10D6]
TA800069

USD 379.00

In Stock

CRABP2 mouse monoclonal antibody, clone OTI10D6 (formerly 10D6)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
CRABP2 Mouse Monoclonal Antibody [Clone ID: OTI10D6]
TA800069S

USD 159.00

In Stock

CRABP2 mouse monoclonal antibody, clone OTI10D6 (formerly 10D6)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
CRABP2 Mouse Monoclonal Antibody [Clone ID: UMAB176]
UM800069

USD 468.00

In Stock

CRABP2 mouse monoclonal antibody,clone UMAB176

Applications 10k-ChIP, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
CRABP2 Mouse Monoclonal Antibody [Clone ID: UMAB176]
UM800069CF

USD 528.00

4 Weeks

Carrier-free (BSA/glycerol-free) CRABP2 mouse monoclonal antibody,clone UMAB176

Applications 10k-ChIP, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
CRABP2 Mouse Monoclonal Antibody [Clone ID: UMAB176]
UM870069

USD 180.00

In Stock

CRABP2 mouse monoclonal antibody,clone UMAB176

Applications 10k-ChIP, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated