Antibodies

View as table Download

Goat Polyclonal CREB3 (aa76-87) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HHDHTYSLPRET, from the internal region of the protein sequence according to NP_006359.3

Rabbit Polyclonal Anti-CREB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the middle region of human CREB3. Synthetic peptide located within the following region: SRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSST

Rabbit Polyclonal Anti-CREB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the C terminal of human CREB3. Synthetic peptide located within the following region: YSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLD

Rabbit Polyclonal Anti-CREB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the middle region of human CREB3. Synthetic peptide located within the following region: PPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

CREB3 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified