Antibodies

Jump to Filters
View as table Download
CREB3L1 Rabbit Polyclonal Antibody
TA345484

USD 410.00

In Stock

Rabbit Polyclonal Anti-CREB3L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1. Synthetic peptide located within the following region: MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDF
CREB3L1 (C-term) Rabbit Polyclonal Antibody
AP17243PU-N

USD 450.00

2 Weeks

CREB3L1 (C-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 488~517 amino acids from the C-terminal region of Human CREB3L1
CREB3L1 Goat Polyclonal Antibody
TA311556

USD 375.00

5 Days

Goat Anti-OASIS / CREB3L1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DFSHSKEWFHDRD, from the C Terminus of the protein sequence according to NP_443086.1.
CREB3L1 Rabbit Polyclonal Antibody
TA341434

USD 310.00

5 Days

Rabbit Polyclonal Anti-CREB3L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1. Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG