Rabbit polyclonal anti-Creb5 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Creb5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: HPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLPTGNQAQVSPATQQMQ |
Rabbit Polyclonal Anti-CREB5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB5 antibody: synthetic peptide directed towards the N terminal of human CREB5. Synthetic peptide located within the following region: CSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNV |
CREB5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 210-330 of human CREB5 (NP_878902.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China