CRISP1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRISP1 |
CRISP1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRISP1 |
Rabbit Polyclonal Anti-CRISP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRISP1 Antibody: synthetic peptide directed towards the N terminal of human CRISP1. Synthetic peptide located within the following region: LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW |
CRISP1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |