Antibodies

Jump to Filters
View as table Download
CRTAC1 Rabbit Polyclonal Antibody
TA344933

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-CRTAC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRTAC1 antibody: synthetic peptide directed towards the N terminal of human CRTAC1. Synthetic peptide located within the following region: FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK
CRTAC1 Rabbit Polyclonal Antibody
TA375108

USD 220.00

3 Weeks

CRTAC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 312-661 of human CRTAC1 (NP_060528.3).
Modifications Unmodified