Antibodies

Jump to Filters
View as table Download
beta Crystallin A3 (CRYBA1) (Center) Rabbit Polyclonal Antibody
AP51091PU-N

USD 450.00

2 Weeks

beta Crystallin A3 (CRYBA1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 111-141 amino acids from the Central region of Human CRYBA1.
beta Crystallin A3 (CRYBA1) Rabbit Polyclonal Antibody
TA340059

USD 375.00

5 Days

Rabbit Polyclonal Anti-CRYBA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRYBA1 antibody: synthetic peptide directed towards the N terminal of human CRYBA1. Synthetic peptide located within the following region: METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS
beta Crystallin A3 (CRYBA1) Rabbit Polyclonal Antibody
TA357009

USD 360.00

5 Days

CRYBA1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CRBA1
beta Crystallin A3 (CRYBA1) Rabbit Polyclonal Antibody
TA375120

USD 220.00

3 Weeks

CRYBA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human CRYBA1 (NP_005199.2).
Modifications Unmodified