Antibodies

View as table Download

Rabbit polyclonal anti-Placental Lactogen antibody

Applications WB
Reactivities Human
Immunogen E. coli expressed recombinant human Placental Lactogen

Rabbit Polyclonal Anti-CSH2 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CSH2 antibody: synthetic peptide directed towards the middle region of human CSH2. Synthetic peptide located within the following region: LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH