Antibodies

Jump to Filters
View as table Download
CSHL1 Rabbit Polyclonal Antibody
TA346286

USD 475.00

5 Days

Rabbit Polyclonal Anti-CSHL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSHL1 antibody: synthetic peptide directed towards the C terminal of human CSHL1. Synthetic peptide located within the following region: GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV
CSHL1 (C-term) Rabbit Polyclonal Antibody
AP51100PU-N

USD 450.00

2 Weeks

CSHL1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 132-152 amino acids from the C-terminal region of human CSHL1