Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CSK rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
Goat Polyclonal Antibody against CSK
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQLEHIKTHELHL, from the C Terminus of the protein sequence according to NP_004374.1. |
Rabbit Polyclonal Anti-CSK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSK antibody: synthetic peptide directed towards the middle region of human CSK. Synthetic peptide located within the following region: SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF |
CSK Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 241-450 of human CSK (NP_004374.1). |
| Modifications | Unmodified |
CSK Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CSK (NP_001120662.1). |
Active filters
Target Symbol
- CSK