Antibodies

Jump to Filters
View as table Download
CSNK1A1L Rabbit Polyclonal Antibody
TA316058

USD 345.00

In Stock

Rabbit polyclonal anti-CKI-a1/L antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a1/L.
CSNK1A1L Rabbit Polyclonal Antibody
TA340392

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK1A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD