Goat Anti-CSRP3 Antibody
| Applications | WB |
| Reactivities | Test: Human, Mouse, Rat. Expected from seq similarity: Human, Mouse, Rat, Dog, Cow |
| Immunogen | Peptide with sequence CGKSLESTNVTDKD, from the internal region of the protein sequence according to NP_003467.1. |
Rabbit Polyclonal Anti-CSRP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CSRP3 Antibody: synthetic peptide directed towards the middle region of human CSRP3. Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG |
Rabbit Polyclonal Anti-CSRP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CSRP3 Antibody: synthetic peptide directed towards the middle region of human CSRP3. Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG |
Rabbit Polyclonal Anti-CSRP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CSRP3 Antibody: synthetic peptide directed towards the C terminal of human CSRP3. Synthetic peptide located within the following region: FRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE |
CSRP3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CSRP3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human CSRP3 (NP_003467.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
