Antibodies

Jump to Filters
View as table Download
Cst6 Rabbit Polyclonal Antibody
TA337639

USD 375.00

5 Days

Rabbit Polyclonal Anti-Cst6 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for anti-Cst6 antibody: synthetic peptide directed towards the middle region of human Cst6. Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD
CST6 Rabbit Polyclonal Antibody
TA349860

USD 345.00

In Stock

Rabbit Polyclonal Anti-CST6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CST6
CST6 Rabbit Polyclonal Antibody
TA364744

USD 380.00

4 Weeks

CST6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CST6