CST9 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 99-127 amino acids from the C-terminal region of human CST9. |
CST9 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 99-127 amino acids from the C-terminal region of human CST9. |
Rabbit Polyclonal Anti-CST9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CST9 Antibody: synthetic peptide directed towards the middle region of human CST9. Synthetic peptide located within the following region: IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK |
CST9 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CST9 |