Antibodies

Jump to Filters
View as table Download
CT45A1 Rabbit Polyclonal Antibody
TA332257

USD 375.00

5 Days

Rabbit Polyclonal Anti-CT45A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CT45A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CT45A1. Synthetic peptide located within the following region: VFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAI