Antibodies

View as table Download

Rabbit Polyclonal Anti-CTNNA3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNA3 antibody is: synthetic peptide directed towards the N-terminal region of Human CTNNA3. Synthetic peptide located within the following region: PLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQ

CTNNA3 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified