Antibodies

Jump to Filters
View as table Download
CTNNA3 Rabbit Polyclonal Antibody
TA338101

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTNNA3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNA3 antibody is: synthetic peptide directed towards the N-terminal region of Human CTNNA3. Synthetic peptide located within the following region: PLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQ
CTNNA3 Rabbit Polyclonal Antibody
TA375197

USD 410.00

3 Weeks

CTNNA3 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified