Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
USD 379.00
In Stock
Goat Polyclonal Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody: Peptide with sequence C-QIPSTQFDAAHPTN, from the internal region of the protein sequence according to NP_001895.1. |
USD 379.00
In Stock
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Rat |
Rabbit polyclonal Catenin-beta (Ab-489) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit Polyclonal Catenin-β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin-β |
Rabbit Polyclonal Catenin- beta (Ser33) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Serine 33 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin- beta (Tyr489) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Tyrosine 489 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin-β (Ser37) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin-β around the phosphorylation site of Serine 37 |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Ab-552) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internalof human CTNNB1. |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |
USD 379.00
2 Weeks
beta Catenin (CTNNB1) pSer33/37/pThr41 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
beta Catenin (CTNNB1) pThr41/pSer45 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human Catenin β |
beta Catenin (CTNNB1) (327-331) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa. 327~331 derived from Human β-catenin |
beta Catenin (CTNNB1) (327-331) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa. 327~331 derived from Human β-catenin |
Rabbit Polyclonal Catenin- beta (Thr41/Ser45) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Threonine 41/Serine 45 |
| Modifications | Phospho-specific |
Rabbit anti Catenin beta Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Catenin-b (pS675) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope –KRLSVEL- with a single phosphorylation site Ser675 of human b-catenin. |
Rabbit anti Catenin-beta (pS33) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope SGIHS with a single phosphorylation site Ser33 of human b-catenin. |
Rabbit anti Catenin-beta (pS33/37) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope SGIHS with dually phosphorylation sites Ser33/Ser37 of human b-catenin. |
Rabbit anti Catenin-beta (Paired 33/37) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope SGIHS without phosphorylation of human b-catenin |
Rabbit anti Catenin-beta (pS37) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope SGIHS with a single phosphorylation site Ser37 of human b-catenin. |
USD 379.00
2 Weeks
Active filters
Target Symbol
- CTNNB1
Filter by
Category
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Adherens junction (162)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (162)
- Basal cell carcinoma (162)
- Colorectal cancer (162)
- Endometrial cancer (162)
- Focal adhesion (162)
- Leukocyte transendothelial migration (162)
- Melanogenesis (162)
- Pathogenic Escherichia coli infection (162)
- Pathways in cancer (162)
- Prostate cancer (162)
- Thyroid cancer (162)
- Tight junction (162)
- Wnt signaling pathway (162)