Antibodies

View as table Download

Rabbit Polyclonal Anti-CUL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CUL3

Rabbit anti-CUL3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL3

Rabbit Polyclonal Anti-CUL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUL3 antibody: synthetic peptide directed towards the C terminal of human CUL3. Synthetic peptide located within the following region: QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTS

Rabbit polyclonal antibody to CUL-3 (cullin 3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 352 and 656 of Cullin 3 (Uniprot ID#Q13618)

Rabbit polyclonal anti-Cullin 3 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Cullin 3.

Rabbit polyclonal anti-Cul3 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1-12 of Human Cul3 (N-terminus) coupled to KLH.

Cullin 3 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (AQVTGSNTRKHILQ)

CUL3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CUL3

CUL3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CUL3

Cullin 3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Cullin 3
Modifications Unmodified

Cullin 3 Rabbit polyclonal Antibody

Applications FC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Cullin 3