Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CXCL1 (KC) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Rabbit Polyclonal Anti-GRO alpha
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha |
Rabbit anti-CXCL1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXCL1 |
Rabbit Polyclonal Anti-CXCL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL1 antibody: synthetic peptide directed towards the middle region of human CXCL1. Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Active filters
Target Symbol
- CXCL1