Antibodies

View as table Download

Anti-Human MIG Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MIG (CXCL9)

Rabbit Polyclonal Anti-CXCL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL9 antibody: synthetic peptide directed towards the middle region of human CXCL9. Synthetic peptide located within the following region: QTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQ

CXCL9 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified