Antibodies

Jump to Filters
View as table Download
CYBA Rabbit Polyclonal Antibody
TA334647

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYBA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBA antibody: synthetic peptide directed towards the middle region of human CYBA. Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP
CYBA (C-term) Rabbit Polyclonal Antibody
AP51159PU-N

USD 450.00

2 Weeks

CYBA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 124-153 amino acids from the C-terminal region of Human Cytochrome b-245 light chain.
CYBA Rabbit Polyclonal Antibody
TA351290

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYBA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBA