Rabbit Polyclonal Anti-CYFIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYFIP1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYFIP1. Synthetic peptide located within the following region: WAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERI |
CYFIP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYFIP1 |
CYFIP1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CYFIP1 (NP_055423.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
