Rabbit polyclonal antibody to CYP24A1 (cytochrome P450, family 24, subfamily A, polypeptide 1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 241 and 514 of CYP24A1 (Uniprot ID#Q07973) |
CYP24A1 (C-term) rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 473~502 from the C-terminal region of Human CYP24A1 |
Rabbit polyclonal Cytochrome P450 24A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 24A1. |
Goat Anti-CYP24A1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RKYDIQATDN, from the internal region of the protein sequence according to NP_000773.2; NP_001122387.1. |
Rabbit Polyclonal Anti-CYP24A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP24A1 antibody: synthetic peptide directed towards the C terminal of human CYP24A1. Synthetic peptide located within the following region: QVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAE |
Rabbit Polyclonal Anti-CYP24A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP24A1 antibody: synthetic peptide directed towards the C terminal of human CYP24A1. Synthetic peptide located within the following region: LNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLS |
CYP24A1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP24A1 |
CYP24A1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 36-448 of human CYP24A1 (NP_001122387.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
