Antibodies

View as table Download

Rabbit Polyclonal Anti-CYP2A13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A13 antibody: synthetic peptide directed towards the C terminal of human CYP2A13. Synthetic peptide located within the following region: DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

CYP2A13 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP2A13

CYP2A13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 306-360 of Human CYP2A13.

Rabbit polyclonal Cytochrome P450 2A13 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2A13.

CYP2A13 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2A13

CYP2A13 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP2A13