Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit polyclonal CYP2E1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1. |
Cytochrome P450 2E1 (CYP2E1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 405 of Human Cytochrome P450. |
Cytochrome P450 2E1 (CYP2E1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide mapping at the C-terminal of human P450ⅡE1 |
USD 1,140.00
9 Weeks
Sheep polyclonal anti-Cytochrome P450 2E1 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYP 2E1 |
Rabbit polyclonal anti-Cytochrome P450 (CYP2E1) antibody
| Reactivities | Human, Rat |
| Immunogen | Cytochrome P450 (CYP2E1) |
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP2E1 |
CYP2E1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP2E1 |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
In Stock
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Active filters
Target Symbol
- CYP2E1