Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal CYP3A5 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5. |
Rabbit Polyclonal Anti-CYP3A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A5 antibody: synthetic peptide directed towards the N terminal of human CYP3A5. Synthetic peptide located within the following region: AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL |
USD 1,140.00
2 Weeks
Cytochrome P450 3A5 (CYP3A5) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP3A5 |
CYP3A5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP3A5 |
Active filters
Target Symbol
- CYP3A5