Antibodies

View as table Download

Rabbit Polyclonal Anti-CA8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA8 antibody: synthetic peptide directed towards the middle region of human CA8. Synthetic peptide located within the following region: TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Rabbit Polyclonal Anti-CA8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA8 antibody: synthetic peptide directed towards the N terminal of human CA8. Synthetic peptide located within the following region: YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC

CA8 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Unmodified